PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000130797
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 242aa    MW: 27293.3 Da    PI: 6.7984
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000130797genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM147.38.1e-4641351128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                    lppG+rF Pt+eelv++yL++k+egk++++ +vi+ +d+y+ ePwdLpk     +++++++w+fF++r++++a+g r+nr+t+sgyWkatg+   v
  MDP0000130797   4 LPPGYRFYPTEEELVSFYLHNKLEGKQVDTRRVIPVIDVYSKEPWDLPKfsgeLCNGDREQWFFFTPRQRREAQGGRPNRTTASGYWKATGSPGYV 99 
                    79****************************99****************656754445677************************************ PP

            NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                    +s++++++g+kkt+vfyk +ap+g+kt+W m+ yr+
  MDP0000130797 100 YSSDNKVIGVKKTMVFYKDKAPTGRKTKWKMNVYRA 135
                    ********************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-483160IPR003441NAC domain
PROSITE profilePS5100547.274162IPR003441NAC domain
PfamPF023651.4E-235134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MEELPPGYRF YPTEEELVSF YLHNKLEGKQ VDTRRVIPVI DVYSKEPWDL PKFSGELCNG  60
DREQWFFFTP RQRREAQGGR PNRTTASGYW KATGSPGYVY SSDNKVIGVK KTMVFYKDKA  120
PTGRKTKWKM NVYRAIEVDN STNTSASASA LVHPSLCRVY VVSGSARAFD RRPLEPVEAQ  180
QKFSNSTEAS TSTLKTTMVD KASSSDETYS HSGELGDLPE TSAGINSSNW EINEVDQEKE  240
SL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-36416717170NAC domain-containing protein 19
4dul_A2e-36416717170NAC domain-containing protein 19
1ut7_B2e-36416717170NO APICAL MERISTEM PROTEIN
1ut7_A2e-36416717170NO APICAL MERISTEM PROTEIN
1ut4_B2e-36416717170NO APICAL MERISTEM PROTEIN
1ut4_A2e-36416717170NO APICAL MERISTEM PROTEIN
3swp_D2e-36416720173NAC domain-containing protein 19
3swp_C2e-36416720173NAC domain-containing protein 19
3swp_B2e-36416720173NAC domain-containing protein 19
3swp_A2e-36416720173NAC domain-containing protein 19
3swm_D2e-36416720173NAC domain-containing protein 19
3swm_C2e-36416720173NAC domain-containing protein 19
3swm_B2e-36416720173NAC domain-containing protein 19
3swm_A2e-36416720173NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009377822.11e-156PREDICTED: NAC domain-containing protein 90 isoform X2
SwissprotQ9FMR36e-79NAC90_ARATH; NAC domain-containing protein 90
TrEMBLM5WHE71e-131M5WHE7_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s22630.12e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87134123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.13e-77NAC domain containing protein 90